PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.07G050600.1.p
Common NameGLYMA_07G050600, LOC100784623
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NAC
Protein Properties Length: 401aa    MW: 45045.5 Da    PI: 6.5644
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.07G050600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1691.5e-52151431128
                  NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatg 87 
                          +ppGfrFhPt+eel+++yL+kkv+ +k++l +vi++vd++k+ePwd+++k+k     +++wyfFs++dkky+tg+r+nrat++g+Wkatg
  Glyma.07G050600.1.p  15 VPPGFRFHPTEEELLQYYLRKKVSYEKIDL-DVIRDVDLNKLEPWDIQEKCKIgttPQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATG 103
                          69****************************.9***************964444222455******************************* PP

                  NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          +dk ++s +g+ +g++ktLvfykgrap+g+k+dW+mheyrl
  Glyma.07G050600.1.p 104 RDKVIYS-NGKRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 143
                          *******.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-599175IPR003441NAC domain
PROSITE profilePS5100557.31615175IPR003441NAC domain
PfamPF023651.4E-2716143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0010047Biological Processfruit dehiscence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MPENMSISVN GQSQVPPGFR FHPTEEELLQ YYLRKKVSYE KIDLDVIRDV DLNKLEPWDI  60
QEKCKIGTTP QNDWYFFSHK DKKYPTGTRT NRATAAGFWK ATGRDKVIYS NGKRIGMRKT  120
LVFYKGRAPH GQKSDWIMHE YRLDDNNTAD TNIVSNVMGD AAQEEGWVVC RIFKKKNHLK  180
TLDSPLASGE DRRSHLFDSC DEGALEQILE QMGRSCKEES SYEGNYRNYG RFTRPYETTG  240
LNNGGGYNDR FMKLPSLESP KSASMESHHN TNNNNNMNSN NNNNGDNNEN NNNNGYHPMI  300
PVEMGTDNEG SFTTHQVSGG DPNNNNNNMV HPLEVGSGGG GLTNWAALDR LVASQLNGQT  360
DASRQLACAF NDPTMYCTSD HHDLHQIPTL RSSSTSAAHT *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-4991779170Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.215670.0hypocotyl| root
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00321DAPTransfer from AT2G46770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0973170.0BT097317.1 Soybean clone JCVI-FLGm-21J14 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003529874.10.0PREDICTED: NAC domain-containing protein 43
SwissprotQ84WP61e-131NAC43_ARATH; NAC domain-containing protein 43
TrEMBLI1KHQ40.0I1KHQ4_SOYBN; Uncharacterized protein
STRINGGLYMA07G05660.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30313374
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-116NAC family protein